PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 743aa    MW: 81855.6 Da    PI: 5.0706
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629760.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.92.3e-2082138157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     r++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  XP_009629760.1  82 RKRYHRHTQHQIQEMENFFKNCPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 138
                     789999************************************************995 PP

2START187.56.9e-592674871206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++e++++a+ +ep+W  s       +n++e+++ f+ + +     +++ea+++++vv+m++ +lve+l+d + +W+ ++      a t+
  XP_009629760.1 267 ELAVAAMEEFIQMAQMGEPLWLPSIdrrtNFLNEEEYVRLFPLGIGpklegFKTEASKDTAVVFMNHIKLVEILMDAN-KWSSMFSsivsTAVTV 360
                     57899********************999999**********99999********************************.*******999999*** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +v+s+g      galq+++ae+q++ p vp Rd +fvRy++++ +g w++vdvS+d  +  p+    +R++++pSg+li++++ng+skvtw+ehv
  XP_009629760.1 361 DVLSTGvagnfnGALQVIFAEFQVPFPQVPtRDCYFVRYCKRSVDGIWAVVDVSLDYLRATPT----ARCRRRPSGCLIQEMPNGYSKVTWIEHV 451
                     ************************************************************996....**************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     + ++  + +++++l++sgla+gak+w atl+rqce+
  XP_009629760.1 452 EADDTAIYSIYKPLLNSGLAFGAKRWIATLDRQCER 487
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2161137IPR009057Homeodomain-like
SuperFamilySSF466891.59E-1971140IPR009057Homeodomain-like
PROSITE profilePS5007117.34679139IPR001356Homeobox domain
SMARTSM003894.8E-1980143IPR001356Homeobox domain
CDDcd000869.13E-2081140No hitNo description
PfamPF000465.9E-1882137IPR001356Homeobox domain
PROSITE patternPS000270114137IPR017970Homeobox, conserved site
SuperFamilySSF559615.16E-35258489No hitNo description
PROSITE profilePS5084842.466258490IPR002913START domain
CDDcd088751.42E-119262486No hitNo description
SMARTSM002342.6E-53267487IPR002913START domain
PfamPF018521.2E-47268487IPR002913START domain
Gene3DG3DSA:3.30.530.202.8E-7335487IPR023393START-like domain
SuperFamilySSF559613.41E-23518734No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MIPANQFSSM IGNDENDVGF VSSSSGLPLG QQSGNIMDMA SNTSESELMP LLTEEEFDSK  60
SGSDNQEGKS SDEQDANQSE RRKRYHRHTQ HQIQEMENFF KNCPHPDDKQ RKELSRELGL  120
EPLQVKFWFQ NKRTQMKNQN ERSELSSLRD ENEKLRTEHV QIREALNNAT SCPSCPICGG  180
PQISLGEMSF EENQLRIENA RLKEEVDRIS AFAAKHLGKP VSSLNVYSSP VTPPSSLDLG  240
NAFGNNGEVL RSSFNGPTEA EKPFIIELAV AAMEEFIQMA QMGEPLWLPS IDRRTNFLNE  300
EEYVRLFPLG IGPKLEGFKT EASKDTAVVF MNHIKLVEIL MDANKWSSMF SSIVSTAVTV  360
DVLSTGVAGN FNGALQVIFA EFQVPFPQVP TRDCYFVRYC KRSVDGIWAV VDVSLDYLRA  420
TPTARCRRRP SGCLIQEMPN GYSKVTWIEH VEADDTAIYS IYKPLLNSGL AFGAKRWIAT  480
LDRQCERLAS AMATNLPDDN TTNMILGGPE GRRSVLKLAE RMVISYCSGV SATAAHQWTT  540
LSGSGSENDV RIMFRKSIND PGRPPGIVMC AATSFWLPIS PKTAFDFLRD ENTRSEWDIL  600
SNGGVIQRLV HIANGRETGN SVSILRVNSS ANLRQNNMLI LQESSTDPTG SFVVYAPVDV  660
PAMNTVINGG DPDYVALLPS GFAILPDGPP GRIAGGSLLT IAFQILVDSV PTAKLSLGSV  720
ATVNKLIACT VDKIRAALLS DTP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629760.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like isoform X1
RefseqXP_009629761.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like isoform X1
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLD7TEM30.0D7TEM3_VITVI; Putative uncharacterized protein
STRINGVIT_12s0059g02310.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9322491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2